PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 55684
Common NameRR1-1, SELMODRAFT_442188
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family ARR-B
Protein Properties Length: 251aa    MW: 28519.7 Da    PI: 6.1755
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
55684genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like87.99.8e-28185238155
  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
              kpr++W+ eLH++Fv+av++L  ++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
    55684 185 KPRVVWSVELHQQFVNAVNKL-NIDKAVPKKILELMDVPGLTRENVASHLQKYRL 238
              79*******************.9*******************************8 PP

2Response_reg82.61.2e-2791171109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+++ + +l+ +l++ +y +v+++ +++ al+ll+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i++++ g+ + + + +  Ga 
         55684   9 VLVVDDDQTTLTILEAMLRRCRY-NVTTCGKATTALALLREHKndFDLVISDVYMPDMDGFKLLELVGL-EMDLPVIMMSTDGDYNNVMKGITHGAC 103
                   89*********************.***************888888*******************87754.558************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +eel++
         55684 104 DYLLKPVRMEELRN 117
                   ************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363924.0E-1451251IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23007.1E-436142No hitNo description
SuperFamilySSF521726.69E-376131IPR011006CheY-like superfamily
SMARTSM004481.1E-327119IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.2768123IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.9E-249118IPR001789Signal transduction response regulator, receiver domain
CDDcd001567.65E-2810122No hitNo description
PROSITE profilePS512949.185182241IPR017930Myb domain
SuperFamilySSF466893.31E-20183242IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-29184243IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-24185238IPR006447Myb domain, plants
PfamPF002495.7E-7187237IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
DQFPVGMRVL VVDDDQTTLT ILEAMLRRCR YNVTTCGKAT TALALLREHK NDFDLVISDV  60
YMPDMDGFKL LELVGLEMDL PVIMMSTDGD YNNVMKGITH GACDYLLKPV RMEELRNIWQ  120
HLVRKRKNEA RETETLTPAE ADKLKGGGGD DVEHLSSACS KKRKDVKEED EGVDHDSEDP  180
SSLKKPRVVW SVELHQQFVN AVNKLNIDKA VPKKILELMD VPGLTRENVA SHLQKYRLYL  240
KRISAQQPQN S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-21181244164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002973731.10.0type B response regulator
SwissprotQ6K8X61e-102ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLD8RRG00.0D8RRG0_SELML; Type B response regulator
STRINGEFJ253910.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP29217120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.11e-103response regulator 2
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]